PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010095680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family BBR-BPC
Protein Properties Length: 312aa    MW: 35321.2 Da    PI: 10.1458
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010095680.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3604.7e-11013121301
       GAGA_bind   1 mdddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalver 77 
                     mdd+ ++e  r+k  yy+              ++ ++l   +++++ms+iaerda+irern+alsek++a+aerd+a+ qrd+ala+r+ al+er
  XP_010095680.1   1 MDDSRQHEtgRHKVeYYRgahspwnmmtqhqvKEpNALV--MNKKIMSIIAERDAAIRERNVALSEKNEALAERDEALRQRDQALAQRDSALMER 93 
                     777777767899988888999999999877663335666..99**************************************************** PP

       GAGA_bind  78 dnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkk.s 171
                     dn+++al+ ++ns++    + ++v +g+k i++  + +  ++++ ++  +e+++++a+pi+   +ea ++ + k+++++k   +k+ k ++kk  
  XP_010095680.1  94 DNAIAALQIRNNSMN---MPVSGVQRGVKRIHHPSN-HLANMTEATYSSKEMQITDAFPITVISSEAIKSGQAKRTKENKAMSSKEPKPPRKKvA 184
                     *********999854...4458999*******8887.679**********************999999999999777766666555554444303 PP

       GAGA_bind 172 ekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafk 266
                     e+ +++ ++++   + ++e++s+d++ln +++Des++PvPvCsCtG+ rqCYkWG+GGWqS+CCtt++S+yPLP+ +++r+aR++grKmS+g+f+
  XP_010095680.1 185 EDLNRRASSDG--IKYRTEWDSQDVGLNLITFDESSMPVPVCSCTGVHRQCYKWGSGGWQSSCCTTNMSMYPLPQIPNKRHARMGGRKMSGGVFT 277
                     34444444444..68******************************************************************************** PP

       GAGA_bind 267 klLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     +lL++Laa+G+dls p+DL+++WAkHGtn+++ti+
  XP_010095680.1 278 RLLSRLAAQGHDLSIPLDLREYWAKHGTNRYITIK 312
                     **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.2E-1451312IPR010409GAGA-binding transcriptional activator
PfamPF062172.2E-1001312IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDDSRQHETG RHKVEYYRGA HSPWNMMTQH QVKEPNALVM NKKIMSIIAE RDAAIRERNV  60
ALSEKNEALA ERDEALRQRD QALAQRDSAL MERDNAIAAL QIRNNSMNMP VSGVQRGVKR  120
IHHPSNHLAN MTEATYSSKE MQITDAFPIT VISSEAIKSG QAKRTKENKA MSSKEPKPPR  180
KKVAEDLNRR ASSDGIKYRT EWDSQDVGLN LITFDESSMP VPVCSCTGVH RQCYKWGSGG  240
WQSSCCTTNM SMYPLPQIPN KRHARMGGRK MSGGVFTRLL SRLAAQGHDL SIPLDLREYW  300
AKHGTNRYIT IK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095680.10.0hypothetical protein L484_012253
SwissprotQ8S8C61e-131BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLW9R7S80.0W9R7S8_9R
STRINGGLYMA05G38430.21e-173(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-133basic pentacysteine 4